PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo7G0024200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 371aa    MW: 39551.5 Da    PI: 6.4232
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo7G0024200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-17350148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed  lv++vk++G g+W+++ r  g+ R++k+c++rw ++l
   Spipo7G0024200  3 KGPWTAAEDAVLVEYVKKHGEGNWNAVQRNTGLSRCGKSCRLRWANHL 50
                     79******************************************9986 PP

2Myb_DNA-binding45.32.1e-145699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+++++E+ l+++++ + G++ W++ a+ ++ gRt++++k++w++
   Spipo7G0024200 56 KGSFSPDEERLILELHSKIGNK-WARMAAQLP-GRTDNEIKNYWNT 99
                     799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.818154IPR017930Myb domain
SuperFamilySSF466891.65E-30297IPR009057Homeodomain-like
SMARTSM007178.3E-15252IPR001005SANT/Myb domain
PfamPF002495.9E-15350IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-23457IPR009057Homeodomain-like
CDDcd001671.38E-11550No hitNo description
PROSITE profilePS5129419.46755105IPR017930Myb domain
SMARTSM007172.0E-1455103IPR001005SANT/Myb domain
PfamPF002498.8E-145699IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2458104IPR009057Homeodomain-like
CDDcd001672.37E-105899No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MKKGPWTAAE DAVLVEYVKK HGEGNWNAVQ RNTGLSRCGK SCRLRWANHL RPNLKKGSFS  60
PDEERLILEL HSKIGNKWAR MAAQLPGRTD NEIKNYWNTR IKRRQRAGLP LYPPELSATN  120
LSLFDFTGAQ PFLFQPTAAG NDDTSFFSVG FGPVAAAAPP PPPFQPPPLF QFSALGNYDL  180
NPPPSPPPLR EPQNFSVKME LPSSQLFPDT HSIAISGAGT GGATVCPLPL ERSSSDLLDA  240
LLRDTQQPLH HERIDGEQSP ALVLGSGGAW LAPHRPPAGG KIKIEAAQDI AIDDDLSALL  300
GAIPAAAMPS AGPPEWPTGG DGEASNGQSS AVTDGALDMQ HVASSLSTAG DENHSWATSR  360
DVFQCVAVKA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3231047107B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276128.17e-85PREDICTED: myb-related protein B-like
STRINGGSMUA_Achr1P17150_0013e-71(Musa acuminata)
STRINGGSMUA_Achr4P23690_0019e-72(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.12e-71myb domain protein 101